| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158311 (CHEMBL763368) |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 5700000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | Beta-carbonic anhydrase | VchβCA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25222.79 |
|---|
| Organism: | Vibrio cholerae |
|---|
| Description: | A0A086SLX8 |
|---|
| Residue: | 222 |
|---|
| Sequence: | MPEIKQLFENNSKWSESIKAETPEYFAKLAKGQNPDFLWIGCADSRVPAERLTGLYSGEL
FVHRNVANQVIHTDLNCLSVVQYAVDVLQVKHIIVCGHYGCGGVTAAIDNPQLGLINNWL
LHIRDYYLKHREYLDQMPAEDRSDKLAEINVAEQVYNLANSTVLQNAWERGQAVEVHGFV
YGIEDGRLEYLGVRCASRSAVEDNYHKALEKILNPNHRLLCR
|
|
|
|---|
| BDBM26984 |
|---|
| n/a |
|---|
| Name | BDBM26984 |
|---|
| Synonyms: | CHEMBL1644697 | CN(-1) | cyanide | iminomethanide |
|---|
| Type | Ion |
|---|
| Emp. Form. | CN |
|---|
| Mol. Mass. | 26.0179 |
|---|
| SMILES | [C-]#N |
|---|
| Structure | 
|
|---|
Search and Browse
