Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase |
---|
Ligand | BDBM26984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158311 (CHEMBL763368) |
---|
pH | 7.5±n/a |
---|
Temperature | 293.15±n/a K |
---|
Ki | 5700000±n/a nM |
---|
Citation | Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Carbonic anhydrase |
---|
Name: | Carbonic anhydrase |
Synonyms: | Beta-carbonic anhydrase | VchβCA |
Type: | Protein |
Mol. Mass.: | 25222.79 |
Organism: | Vibrio cholerae |
Description: | A0A086SLX8 |
Residue: | 222 |
Sequence: | MPEIKQLFENNSKWSESIKAETPEYFAKLAKGQNPDFLWIGCADSRVPAERLTGLYSGEL
FVHRNVANQVIHTDLNCLSVVQYAVDVLQVKHIIVCGHYGCGGVTAAIDNPQLGLINNWL
LHIRDYYLKHREYLDQMPAEDRSDKLAEINVAEQVYNLANSTVLQNAWERGQAVEVHGFV
YGIEDGRLEYLGVRCASRSAVEDNYHKALEKILNPNHRLLCR
|
|
|
BDBM26984 |
---|
n/a |
---|
Name | BDBM26984 |
Synonyms: | CHEMBL1644697 | CN(-1) | cyanide | iminomethanide |
Type | Ion |
Emp. Form. | CN |
Mol. Mass. | 26.0179 |
SMILES | [C-]#N |
Structure |
|