| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gamma carbonic anhydrase family protein |
|---|
| Ligand | BDBM50278323 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158313 (CHEMBL763370) |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 8800000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Gamma carbonic anhydrase family protein |
|---|
| Name: | Gamma carbonic anhydrase family protein |
|---|
| Synonyms: | Gamma-carbonic anhydrase | VchγCA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19753.38 |
|---|
| Organism: | Vibrio cholerae |
|---|
| Description: | A0A0H7HLM5 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MSSIRSYKGIVPKLGEGVYIDSSAVLVGDIELGDDASIWPLVAARGDVNHIRIGKRTNIQ
DGSVLHVTHKNAENPNGYPLCIGDDVTIGHKVMLHGCTIHDRVLVGMGSIVLDGAVIEND
VMIGAGSLVPPGKRLESGFLYMGSPVKQARPLNDKERAFLVKSSSNYVQSKNDYLNDVKT
VRE
|
|
|
|---|
| BDBM50278323 |
|---|
| n/a |
|---|
| Name | BDBM50278323 |
|---|
| Synonyms: | CHEMBL471245 | sodium trithiocarbonate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | CS3 |
|---|
| Mol. Mass. | 108.207 |
|---|
| SMILES | [S-]C([S-])=S |
|---|
| Structure | 
|
|---|
Search and Browse
