Reaction Details |
| Report a problem with these data |
Target | Gamma carbonic anhydrase family protein |
---|
Ligand | BDBM50010231 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158313 (CHEMBL763370) |
---|
pH | 7.5±n/a |
---|
Temperature | 293.15±n/a K |
---|
Ki | 440000±n/a nM |
---|
Citation | Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Gamma carbonic anhydrase family protein |
---|
Name: | Gamma carbonic anhydrase family protein |
Synonyms: | Gamma-carbonic anhydrase | VchγCA |
Type: | Protein |
Mol. Mass.: | 19753.38 |
Organism: | Vibrio cholerae |
Description: | A0A0H7HLM5 |
Residue: | 183 |
Sequence: | MSSIRSYKGIVPKLGEGVYIDSSAVLVGDIELGDDASIWPLVAARGDVNHIRIGKRTNIQ
DGSVLHVTHKNAENPNGYPLCIGDDVTIGHKVMLHGCTIHDRVLVGMGSIVLDGAVIEND
VMIGAGSLVPPGKRLESGFLYMGSPVKQARPLNDKERAFLVKSSSNYVQSKNDYLNDVKT
VRE
|
|
|
BDBM50010231 |
---|
n/a |
---|
Name | BDBM50010231 |
Synonyms: | CHEMBL107217 | Ditiocarb sodium | Sodium salt of Diethyl-dithiocarbamic acid(DDC) | US9180183, DDTC | sodium N,N-diethyl-dithiocarbamate | sodium diethyldithiocarbamate |
Type | Small organic molecule |
Emp. Form. | C5H10NS2 |
Mol. Mass. | 148.27 |
SMILES | CCN(CC)C([S-])=S |
Structure |
|