| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [42-168] |
|---|
| Ligand | BDBM254915 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | AlphaLisa Binding Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 28±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Albrecht, BK; Hewitt, MC; Gehling, VS; Vaswani, RG Benzo [C] isoxazoloazepine bromodomain inhibitors and uses thereof US Patent US9493483 Publication Date 11/15/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [42-168] |
|---|
| Name: | Bromodomain-containing protein 4 [42-168] |
|---|
| Synonyms: | BRD4 | BRD4 BD1 (aa 42-168) | BRD4_HUMAN | Bromodomain-containing protein 4 Bromo Domain 1 | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15054.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O60885[42-168] |
|---|
| Residue: | 127 |
|---|
| Sequence: | STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKII
KTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKI
NELPTEE
|
|
|
|---|
| BDBM254915 |
|---|
| n/a |
|---|
| Name | BDBM254915 |
|---|
| Synonyms: | US9493483, 403 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21ClN4O2 |
|---|
| Mol. Mass. | 456.924 |
|---|
| SMILES | Cc1noc2[C@H](CC(N)=O)N=C(c3ccc(Cl)cc3)c3cc(ccc3-c12)-c1ccc(C)nc1 |r,t:10| |
|---|
| Structure | 
|
|---|
Search and Browse
