Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM257515 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | PPlase Assay |
---|
Ki | 5.9±0.66 nM |
---|
Citation | Gregory, MA; Kendrew, SG; Moss, SJ; Wilkinson, B Rapamycin analogues and their pharmaceutical use US Patent US9505773 Publication Date 11/29/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM257515 |
---|
n/a |
---|
Name | BDBM257515 |
Synonyms: | US9505773, 8 |
Type | Small organic molecule |
Emp. Form. | C47H73NO11 |
Mol. Mass. | 828.0826 |
SMILES | CO[C@@H]1C[C@H](C[C@@H](C)C2C\C=C(C)\[C@@H](O)CC(=O)[C@H](C)C[C@H](C)\C=C\C=C\C=C(C)\[C@H](C[C@@H]3CC[C@@H](C)[C@@](O)(O3)C(=O)C(=O)N3CCCC[C@H]3C(=O)O2)OC)CC[C@H]1O |r,c:10,27,t:23,25| |
Structure |
|