| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM412451 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human ELISA assay |
|---|
| IC50 | 11.0±n/a nM |
|---|
| Citation |  Chen, S; Bohnert, G; Jiang, J; Xia, Z Compounds for inflammation and immune-related uses US Patent US10399967 Publication Date 9/3/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM412451 |
|---|
| n/a |
|---|
| Name | BDBM412451 |
|---|
| Synonyms: | 5-bromo-N-(5-(2-chloro-5- cyclopropoxyphenyl)pyrazin-2-yl)-4- methylnicotinamide | US10399967, Compound 81 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16BrClN4O2 |
|---|
| Mol. Mass. | 459.724 |
|---|
| SMILES | Cc1c(Br)cncc1C(=O)Nc1cnc(cn1)-c1cc(OC2CC2)ccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
