| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metalloproteinase inhibitor 2 |
|---|
| Ligand | BDBM413580 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | 21.0±n/a nM |
|---|
| Citation |  Prades Cosano, R; Seco Moral, J; Tarragó Clua, MT Gelatinase inhibitors and use thereof US Patent US10414797 Publication Date 9/17/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metalloproteinase inhibitor 2 |
|---|
| Name: | Metalloproteinase inhibitor 2 |
|---|
| Synonyms: | Metalloproteinase inhibitor 2 (TIMP2) | TIMP-2 | TIMP2 | TIMP2_CRILO | Tissue inhibitor of metalloproteinases 2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 21943.02 |
|---|
| Organism: | Cricetulus longicaudatus (Long-tailed dwarf hamster) (Chinese hamster) |
|---|
| Description: | Q60453 |
|---|
| Residue: | 196 |
|---|
| Sequence: | RACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDK
DIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSL
NHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWY
RGAAPPKQEFLDIEDP
|
|
|
|---|
| BDBM413580 |
|---|
| n/a |
|---|
| Name | BDBM413580 |
|---|
| Synonyms: | (2 S)-1-[(2S)-2-[acetyl(methyl)amino]propanoyl]-N-[(1S)-1-[[(1S)-3-[(3,5-difluorobenzoyl)amino]-1-(hydroxycarbamoyl)propyl]carbamoyl]-2-methyl-butyl]-N-methyl-pyrrolidine-2-carboxamide | US10414797, Example 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H42F2N6O7 |
|---|
| Mol. Mass. | 624.6766 |
|---|
| SMILES | CCC(C)[C@H](N(C)C(=O)[C@@H]1CCCN1C(=O)[C@H](C)N(C)C(C)=O)C(=O)N[C@@H](CCNC(=O)c1cc(F)cc(F)c1)C(=O)NO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
