| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 2 [253-363] |
|---|
| Ligand | BDBM422080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Assay 1: affinity of compounds to cIAP1-BIR3, cIAP2-BIR3, XIAP-BIR3 |
|---|
| IC50 | <10.00±n/a nM |
|---|
| Citation |  Sun, F; Ding, CZ; Cai, Z; Qian, W; Hu, G; Li, J; Chen, S Benzimidazole-linked indole compound acting as novel divalent IAP antagonist US Patent US10508103 Publication Date 12/17/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 2 [253-363] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 2 [253-363] |
|---|
| Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Baculoviral IAP repeat-containing protein 2 | HIAP-2 | IAP homolog B | Inhibitor of apoptosis protein 2 | MIHB | RING finger protein 48 | RNF48 | TNFR2-TRAF-signaling complex protein 2 | cIAP-1 BIR3 |
|---|
| Type: | BIR3 domain |
|---|
| Mol. Mass.: | 12929.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human cIAP1 BIR3 domain (residues 253-363) was used in binding assays. |
|---|
| Residue: | 111 |
|---|
| Sequence: | SLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGG
LRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTS
|
|
|
|---|
| BDBM422080 |
|---|
| n/a |
|---|
| Name | BDBM422080 |
|---|
| Synonyms: | US10508103, Embodiment 36 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H61F4N9O4 |
|---|
| Mol. Mass. | 880.0281 |
|---|
| SMILES | CCC[C@H](NC(=O)[C@H](C)NC)C(=O)N1C[C@@H](F)C[C@H]1Cn1c(nc2cc(F)ccc12)-c1[nH]c2cc(F)ccc2c1C[C@@H]1C[C@H](F)CN1C(=O)[C@@H](NC(=O)[C@H](C)NC)C1CCCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
