| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM296840 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TNF or CD40L-Induced HEK-Blue Assay |
|---|
| IC50 | <1000±n/a nM |
|---|
| Citation |  Marcin, LR; Wrobleski, ST; Dhar, TM Heterocyclic compounds useful as inhibitors of TNF US Patent US10112944 Publication Date 10/30/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM296840 |
|---|
| n/a |
|---|
| Name | BDBM296840 |
|---|
| Synonyms: | 4-(5-(1-(2,5-Dimethylphenyl)-1,2,3,4-tetrahydroimidazo[1,2-a:5,4-b′]dipyridin-8-yl)pyrimidin-2-yl)morpholine | US10112944, Example 14 | US10112944, Example 33 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H28N6O |
|---|
| Mol. Mass. | 440.5401 |
|---|
| SMILES | Cc1ccc(C)c(c1)N1CCCc2nc3ccc(cn3c12)-c1cnc(nc1)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
