| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [57-168] |
|---|
| Ligand | BDBM220664 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Assay |
|---|
| Ki | 69.9±n/a nM |
|---|
| Citation |  Hasvold, LA; Liu, D; McDaniel, KF; Pratt, J; Sheppard, G; Wang, L Bromodomain inhibitors US Patent US10633379 Publication Date 4/28/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [57-168] |
|---|
| Name: | Bromodomain-containing protein 4 [57-168] |
|---|
| Synonyms: | BRD4 | BRD4_HUMAN | Bromodomain-containing protein 4 (BRD4) | Bromodomain-containing protein 4 (BRD4)(aa 57-168) | Bromodomain-containing protein 4 (BRD4-BD1) | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13496.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BDI: amino acids K57-E168 |
|---|
| Residue: | 112 |
|---|
| Sequence: | KRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLEN
NYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
|
|
|
|---|
| BDBM220664 |
|---|
| n/a |
|---|
| Name | BDBM220664 |
|---|
| Synonyms: | US10633379, Compound Y | US9296741, 253 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H21F2N3O5S |
|---|
| Mol. Mass. | 501.502 |
|---|
| SMILES | CCNC(=O)c1cc2c(cn(C)c(=O)c2[nH]1)-c1cc(ccc1Oc1ccc(F)cc1F)S(C)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
