| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pulmonary surfactant-associated protein A1 |
|---|
| Ligand | BDBM445786 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of fibrosis |
|---|
| IC50 | 129±n/a nM |
|---|
| Citation |  Hood, J; Kumar KC, S; Wallace, DM; Mittapalli, GK; Hofilena, BJ; Mak, CC; Bollu, V; Eastman, B 5-substituted indazole-3-carboxamides and preparation and use thereof US Patent US10669240 Publication Date 6/2/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Pulmonary surfactant-associated protein A1 |
|---|
| Name: | Pulmonary surfactant-associated protein A1 |
|---|
| Synonyms: | 35 kDa pulmonary surfactant-associated protein | Alveolar proteinosis protein | COLEC4 | Collectin-4 | PSAP | PSP-A | PSPA | SFTA1_HUMAN | SFTP1 | SFTPA | SFTPA1 | SFTPA1B | SP-A | SP-A1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26234.12 |
|---|
| Organism: | Human |
|---|
| Description: | Q8IWL2 |
|---|
| Residue: | 248 |
|---|
| Sequence: | MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
|
|
|
|---|
| BDBM445786 |
|---|
| n/a |
|---|
| Name | BDBM445786 |
|---|
| Synonyms: | US10669240, Compound 82 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26N6O |
|---|
| Mol. Mass. | 426.5135 |
|---|
| SMILES | CC1CCN(Cc2cncc(c2)-c2ccc3[nH]nc(C(=O)Nc4cccnc4)c3c2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
