| Reaction Details |
|---|
 | Report a problem with these data |
| Target | N-formyl peptide receptor 2 |
|---|
| Ligand | BDBM450307 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FPR2 and FPR1 Cyclic Adenosine Monophosphate (cAMP) Assays |
|---|
| EC50 | 0.077±n/a nM |
|---|
| Citation |  Shirude, PS; Baligar, V; Seshadri, B; Chattopadhyay, AK; Wurtz, NR; Kick, EK Phenylpyrrolidinone formyl peptide 2 receptor agonists US Patent US10676431 Publication Date 6/9/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| N-formyl peptide receptor 2 |
|---|
| Name: | N-formyl peptide receptor 2 |
|---|
| Synonyms: | ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | FPR2 | FPR2_HUMAN | FPRH1 | FPRL1 | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | LXA4R | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38968.35 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25090 |
|---|
| Residue: | 351 |
|---|
| Sequence: | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
|
|
|
|---|
| BDBM450307 |
|---|
| n/a |
|---|
| Name | BDBM450307 |
|---|
| Synonyms: | US10676431, Example 70 | US11117861, Example 70 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H21ClF4N3O3P |
|---|
| Mol. Mass. | 553.873 |
|---|
| SMILES | CP(C)(=O)c1c(F)cccc1-c1ccc(N2CC[C@@H](NC(=O)Nc3ccc(Cl)cc3F)C2=O)c(F)c1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
