| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein S100-A9 |
|---|
| Ligand | BDBM299092 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | S100A9-RAGE inhibition assay |
|---|
| IC50 | <1000±n/a nM |
|---|
| Citation |  Fritzson, I; Liberg, D; East, S; Mackinnon, C; Prevost, N N-(heteroaryl)-sulfonamide derivatives useful as S100-inhibitors US Patent US10125125 Publication Date 11/13/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein S100-A9 |
|---|
| Name: | Protein S100-A9 |
|---|
| Synonyms: | CAGB | CFAG | Calgranulin-B | Calprotectin L1H subunit | Leukocyte L1 complex heavy chain | MRP-14 | MRP14 | Migration inhibitory factor-related protein 14 | S100 calcium-binding protein A9 | S100A9 | S10A9_HUMAN | p14 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13239.84 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 114 |
|---|
| Sequence: | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
|
|
|
|---|
| BDBM299092 |
|---|
| n/a |
|---|
| Name | BDBM299092 |
|---|
| Synonyms: | (+/-)-N-(5-bromo-3-hydroxypyrazin-2-yl)-1-(3,5-dichlorophenyl)-2,2,2-trifluoroethane-1-sulfonamide | US10125125, Example 141 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H7BrCl2F3N3O3S |
|---|
| Mol. Mass. | 481.072 |
|---|
| SMILES | Oc1nc(Br)cnc1NS(=O)(=O)C(c1cc(Cl)cc(Cl)c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
