| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nuclear receptor ROR-gamma [262-507] |
|---|
| Ligand | BDBM382483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | 9.00±n/a nM |
|---|
| Citation |  Duan, J; Dhar, TG; Marcoux, D; Cherney, RJ Tricyclic sulfones as RORγ modulators US Patent US10711020 Publication Date 7/14/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nuclear receptor ROR-gamma [262-507] |
|---|
| Name: | Nuclear receptor ROR-gamma [262-507] |
|---|
| Synonyms: | NR1F3 | Nuclear receptor ROR-gamma | Nuclear receptor ROR-gamma (aa 262-507) | ROR-gamma (A262-S507) | RORC | RORG | RORG_HUMAN | RZRG |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 28605.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 262-507 |
|---|
| Residue: | 246 |
|---|
| Sequence: | APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFS
|
|
|
|---|
| BDBM382483 |
|---|
| n/a |
|---|
| Name | BDBM382483 |
|---|
| Synonyms: | US10273259, Example 192 | US10273259, Example 193 | US10711020, Example 193 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23ClF7NO5S2 |
|---|
| Mol. Mass. | 662.036 |
|---|
| SMILES | FC(F)(F)C(F)(c1ccc2c(CCC3N(CCC23S(=O)(=O)c2ccc(Cl)cc2)C(=O)C2CCS(=O)(=O)C2)c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
