| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM456221 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Thallium Flux Assay |
|---|
| IC50 | 6.60±n/a nM |
|---|
| Citation |  Gunaga, P; Bhide, RS; Bora, RO; Panda, M; Yadav, ND; Priestley, ES; Richter, J Substituted bicycle heterocyclic derivatives useful as ROMK channel inhibitors US Patent US10723723 Publication Date 7/28/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 44809.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_223460826 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
|---|
| BDBM456221 |
|---|
| n/a |
|---|
| Name | BDBM456221 |
|---|
| Synonyms: | (R)-6-(5-(((2-hydroxy-2- (4-methyl-1-oxo-1,3- dihydroisobenzofuran-5- yl)ethyl)amino)methyl) thiazol-2-yl)-4- methylnicotinonitrile | US10723723, Example 128 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20N4O3S |
|---|
| Mol. Mass. | 420.484 |
|---|
| SMILES | Cc1cc(ncc1C#N)-c1ncc(CNC[C@H](O)c2ccc3C(=O)OCc3c2C)s1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
