Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 5 activator 1 [99-307] |
---|
Ligand | BDBM7363 |
---|
Substrate/Competitor | Histone H1 |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 2000±n/a nM |
---|
Comments | extracted |
---|
Citation | Mettey, Y; Gompel, M; Thomas, V; Garnier, M; Leost, M; Ceballos-Picot, I; Noble, M; Endicott, J; Vierfond, JM; Meijer, L Aloisines, a new family of CDK/GSK-3 inhibitors. SAR study, crystal structure in complex with CDK2, enzyme selectivity, and cellular effects. J Med Chem46:222-36 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 5 activator 1 [99-307] |
---|
Name: | Cyclin-dependent kinase 5 activator 1 [99-307] |
Synonyms: | CDK5/p25 | Cyclin-Dependent Kinase 5 (CDK5) |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Cyclin-dependent kinase 5 |
Synonyms: | CDK5 | CDK5_HUMAN | CDKN5 | Cell division protein kinase 5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 | Cyclin-dependent-like kinase 5 (CDK5) | PSSALRE | Serine/threonine-protein kinase PSSALRE | Tau protein kinase II catalytic subunit |
Type: | Enzyme Subunit |
Mol. Mass.: | 33308.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 292 |
Sequence: | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
|
|
|
Component 2 |
Name: | Cyclin-dependent kinase 5 activator 1 [99-307] |
Synonyms: | CD5R1_HUMAN | CDK5R | CDK5R1 | Cyclin-Dependent Kinase 5 Activator | Cyclin-dependent kinase 5 activator 1, p25 | NCK5A | TPKII regulatory subunit | p25 |
Type: | Enzyme Subunit |
Mol. Mass.: | 23250.56 |
Organism: | Homo sapiens (Human) |
Description: | Q15078 aa 99-307 |
Residue: | 209 |
Sequence: | AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEF
LCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGS
DHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINAD
PHYFTQVFSDLKNESGQEDKKRLLLGLDR
|
|
|
BDBM7363 |
---|
Histone H1 |
---|
Name: | Histone H1 |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 3 |
Sequence: | |