| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM468566 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition of Purified HIV-1 Protease |
|---|
| IC50 | 12.2±n/a nM |
|---|
| Citation |  Jude-Fishburn, CS; VanderVeen, LA; Riley, TA Protease inhibitors having enhanced features US Patent US10806794 Publication Date 10/20/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 protease wild type |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 10757.68 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | O90785 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
|---|
| BDBM468566 |
|---|
| n/a |
|---|
| Name | BDBM468566 |
|---|
| Synonyms: | US10806794, Compound mPEG7-amide-Tipranavir |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H63F3N2O12S |
|---|
| Mol. Mass. | 925.059 |
|---|
| SMILES | CCC[C@@]1(CCc2ccccc2)CC(O)=C([C@H](CC)c2cccc(c2)N(CCOCCOCCOCCOCCOCCOCCOC)S(=O)(=O)c2ccc(cn2)C(F)(F)F)C(=O)O1 |t:15| |
|---|
| Structure | 
|
|---|
Search and Browse
