| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM50213021 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition of Purified HIV-1 Protease |
|---|
| IC50 | 0.050±n/a nM |
|---|
| Citation |  Jude-Fishburn, CS; VanderVeen, LA; Riley, TA Protease inhibitors having enhanced features US Patent US10806794 Publication Date 10/20/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 protease wild type |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 10757.68 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | O90785 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
|
|
|
|---|
| BDBM50213021 |
|---|
| n/a |
|---|
| Name | BDBM50213021 |
|---|
| Synonyms: | CHEBI:63621 | Fortovase | Invirase | Ro-31-8959 | Ro-318959000 | Saquinavir | US10806794, Compound Saquinavir |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H50N6O5 |
|---|
| Mol. Mass. | 670.8408 |
|---|
| SMILES | [H][C@@]12CCCC[C@]1([H])CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc3ccccc3n1)[C@@H](C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
