Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Synthase Kinase-3, beta
LigandBDBM7491
Substrate/CompetitorGSK-3 Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
pH7.5±n/a
Temperature303.15±n/a K
IC50 10±n/a nM
Citation Kunick CLauenroth KLeost MMeijer LLemcke T 1-Azakenpaullone is a selective inhibitor of glycogen synthase kinase-3 beta. Bioorg Med Chem Lett 14:413-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Glycogen Synthase Kinase-3, beta
Name:Glycogen Synthase Kinase-3, beta
Synonyms:GSK-3, beta
Type:Enzyme
Mol. Mass.:46754.43
Organism:Rattus norvegicus (rat)
Description:The rat GSK-3 beta cDNA was inserted into the baculovirus vector. The protein was purified from virus-infected sf9 insect cells
Residue:420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDM
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7491
GSK-3 Peptide Substrate
Name:GSK-3 Peptide Substrate
Synonyms:GS-1 Peptide | Phospho-GS2 Substrate Peptide
Type:Peptide
Mol. Mass.:3045.17
Organism:n/a
Description:n/a
Residue:27
Sequence:
YRRAAVPPSPSLSRHSSPHQS(PO4)EDEEE