Reaction Details |
| Report a problem with these data |
Target | Malignant T-cell-amplified sequence 1 |
---|
Ligand | BDBM476285 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biological Activity of Selected Compounds of the Invention |
---|
EC50 | <250±n/a nM |
---|
Citation | Bannister, TD; Wang, H; Wang, C; Cleveland, JL Pteridine dione monocarboxylate transporter inhibitors US Patent US10874675 Publication Date 12/29/2020 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Malignant T-cell-amplified sequence 1 |
---|
Name: | Malignant T-cell-amplified sequence 1 |
Synonyms: | MCT-1 | MCT1 | MCTS1 | MCTS1_HUMAN | Multiple copies T-cell malignancies |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 20563.62 |
Organism: | Homo sapiens (human) |
Description: | n/a |
Residue: | 181 |
Sequence: | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|
|
BDBM476285 |
---|
n/a |
---|
Name | BDBM476285 |
Synonyms: | US10874675, Example 24 |
Type | Small organic molecule |
Emp. Form. | C23H28BrFN4O4 |
Mol. Mass. | 523.395 |
SMILES | CC(C)Cn1c2nc(COc3cc(F)ccc3Br)c(CCCCCO)nc2c(=O)n(C)c1=O |
Structure |
|