| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Malignant T-cell-amplified sequence 1 |
|---|
| Ligand | BDBM476293 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Activity of Selected Compounds of the Invention |
|---|
| EC50 | <1000±n/a nM |
|---|
| Citation |  Bannister, TD; Wang, H; Wang, C; Cleveland, JL Pteridine dione monocarboxylate transporter inhibitors US Patent US10874675 Publication Date 12/29/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Malignant T-cell-amplified sequence 1 |
|---|
| Name: | Malignant T-cell-amplified sequence 1 |
|---|
| Synonyms: | MCT-1 | MCT1 | MCTS1 | MCTS1_HUMAN | Multiple copies T-cell malignancies |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 20563.62 |
|---|
| Organism: | Homo sapiens (human) |
|---|
| Description: | n/a |
|---|
| Residue: | 181 |
|---|
| Sequence: | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|
|
|---|
| BDBM476293 |
|---|
| n/a |
|---|
| Name | BDBM476293 |
|---|
| Synonyms: | US10874675, Example 30 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N6O4 |
|---|
| Mol. Mass. | 478.5435 |
|---|
| SMILES | CC(C)Cn1c2nc(COc3cccc4nccnc34)c(CCCCCO)nc2c(=O)n(C)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
