Reaction Details |
| Report a problem with these data |
Target | Alpha-synuclein |
---|
Ligand | BDBM481157 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Direct Determination By Fluorescence |
---|
Kd | 0.490±0.2 nM |
---|
Citation | Routier, S; Suzenet, F; Chalon, S; Buron, F; Vercouillie, J; Melki, R; Boiaryna, L; Guilloteau, D; Pieri, L Compounds for using in imaging and particularly for the diagnosis of neurodegenerative diseases US Patent US10906900 Publication Date 2/2/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Alpha-synuclein |
---|
Name: | Alpha-synuclein |
Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
Type: | Protein |
Mol. Mass.: | 14451.42 |
Organism: | Homo sapiens (Human) |
Description: | P37840 |
Residue: | 140 |
Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
BDBM481157 |
---|
n/a |
---|
Name | BDBM481157 |
Synonyms: | US10906900, Reference 25a |
Type | Small organic molecule |
Emp. Form. | C21H17N3S |
Mol. Mass. | 343.445 |
SMILES | CN(C)c1ccc(cc1)C#Cc1cc2ccc(nc2[nH]1)-c1cccs1 |
Structure |
|