| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM481160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Direct Determination By Fluorescence |
|---|
| Kd | 2.40±1 nM |
|---|
| Citation |  Routier, S; Suzenet, F; Chalon, S; Buron, F; Vercouillie, J; Melki, R; Boiaryna, L; Guilloteau, D; Pieri, L Compounds for using in imaging and particularly for the diagnosis of neurodegenerative diseases US Patent US10906900 Publication Date 2/2/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM481160 |
|---|
| n/a |
|---|
| Name | BDBM481160 |
|---|
| Synonyms: | US10906900, Reference 28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16FN3 |
|---|
| Mol. Mass. | 293.3381 |
|---|
| SMILES | CN(CCF)c1ccc(cc1)C#Cc1cc2cccnc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
