| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50199795 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 38.6±0.94 nM |
|---|
| Citation |  Newman, AH; Okunola-Bakare, OM; Cao, J Potent and selective inhibitors of monoamine transporters; method of making; and use thereof US Patent US10913711 Publication Date 2/9/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20953.88 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q5U3Y7 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
|---|
| BDBM50199795 |
|---|
| n/a |
|---|
| Name | BDBM50199795 |
|---|
| Synonyms: | CHEMBL3909363 | US10913711, Compound 9j | US11555013, Compound 9j | US9862679, Compound 9j |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H32F2N2OS |
|---|
| Mol. Mass. | 482.628 |
|---|
| SMILES | OC(CN1CCN(CCSC(c2ccc(F)cc2)c2ccc(F)cc2)CC1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
