| Reaction Details |
|---|
 | Report a problem with these data |
| Target | AP-4 complex subunit sigma-1 |
|---|
| Ligand | BDBM484148 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human Sigma-1 Receptor Radioligand Assay |
|---|
| Ki | <100±n/a nM |
|---|
| Citation |  Virgili-Bernado, M; Almansa-Rosales, C; Alegret-Molina, C Oxadiazaspiro compounds for the treatment of drug abuse and addiction US Patent US10927128 Publication Date 2/23/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| AP-4 complex subunit sigma-1 |
|---|
| Name: | AP-4 complex subunit sigma-1 |
|---|
| Synonyms: | AP-4 complex subunit sigma-1 | AP4S1 | AP4S1_HUMAN | Sigma-1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17000.04 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Sigma-1 0 HUMAN::Q9Y587 |
|---|
| Residue: | 144 |
|---|
| Sequence: | MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSES
|
|
|
|---|
| BDBM484148 |
|---|
| n/a |
|---|
| Name | BDBM484148 |
|---|
| Synonyms: | (S)-9-(4-fluorobenzyl)-4- isopropyl-2-methyl-1-oxa-4,9- diazaspiro[5.5]undecan-3- one | US10927128, Example 69 | US11649248, Example 69 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H27FN2O2 |
|---|
| Mol. Mass. | 334.4283 |
|---|
| SMILES | CC(C)N1CC2(CCN(Cc3ccc(F)cc3)CC2)O[C@@H](C)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
