| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM50186426 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Ki | 21000±n/a nM |
|---|
| Citation |  Jorgensen, WL; Dziedzic, P; Cisneros, J Biaryltriazole inhibitors of macrophage migration inhibitory factor US Patent US10968198 Publication Date 4/6/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | GIF | GLIF | Glycosylation-inhibiting factor | L-dopachrome isomerase | L-dopachrome tautomerase | MIF | MIF/CD74 (Macrophage migration inhibitory factor and HLA-DR antigens-associated invariant chain) | MIF_HUMAN | MMIF | Macrophage migration inhibitory factor | Macrophage migration inhibitory factor (MIF) | Phenylpyruvate tautomerase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12478.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14174 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC
SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
|
|---|
| BDBM50186426 |
|---|
| n/a |
|---|
| Name | BDBM50186426 |
|---|
| Synonyms: | CHEMBL210858 | US10336721, ISO-1 | US10968198, ISO-1 | US8618147, ISO-1 | methyl 2-(3-(4-hydroxyphenyl)-4,5-dihydroisoxazol-5-yl)acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H13NO4 |
|---|
| Mol. Mass. | 235.2359 |
|---|
| SMILES | COC(=O)CC1CC(=NO1)c1ccc(O)cc1 |c:7| |
|---|
| Structure | 
|
|---|
Search and Browse
