| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Ligand | BDBM363583 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Assays for IDH1m (R132H or R132C) Inhibitors |
|---|
| IC50 | <100±n/a nM |
|---|
| Citation |  Lemieux, RM; Popovici-Muller, J; Travins, J; Cai, Z; Cui, D; Zhou, D Therapeutically active compounds and their methods of use US Patent US11021515 Publication Date 6/1/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
|---|
| Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 46641.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
|---|
| Residue: | 414 |
|---|
| Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
|---|
| BDBM363583 |
|---|
| n/a |
|---|
| Name | BDBM363583 |
|---|
| Synonyms: | US10640534, Compound 75 | US10689414, Compound 75 | US10717764, Compound 75 | US11021515, Compound 75 | US11667673, Compound 75 | US9850277, Compound 75 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H29ClF3N5O3 |
|---|
| Mol. Mass. | 624.053 |
|---|
| SMILES | Fc1cccc(c1)N([C@H](C(=O)NC1CCC(F)(F)CC1)c1ccccc1Cl)C(=O)[C@@H]1CCCC(=O)N1c1cc(ccn1)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
