| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM7977 |
|---|
| Substrate/Competitor | Peptide Substrate |
|---|
| Meas. Tech. | Enzyme Inhibition Measurements |
|---|
| Ki | 4.9±n/a nM |
|---|
| Citation |  Johansson, PO; Chen, Y; Belfrage, AK; Blackman, MJ; Kvarnstrom, I; Jansson, K; Vrang, L; Hamelink, E; Hallberg, A; Rosenquist, A; Samuelsson, B Design and synthesis of potent inhibitors of the malaria aspartyl proteases plasmepsin I and II. Use of solid-phase synthesis to explore novel statine motifs. J Med Chem47:3353-66 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM7977 |
|---|
| Peptide Substrate |
|---|
| Name: | Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 3501.67 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 31 |
|---|
| Sequence: | DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS
|
|
|
|---|
Search and Browse
