Search and Browse
Download
Enter Data
|
Assay Method Information |
|
| | EGFR, MAPK and PDK Inhibitory Acitivity Assay |
| Description: | EGFR was incubated with 8 mM MOPS (pH 7.0), 0.2 mM EDTA, 10 mM MnCl2, 0.1 mg/mL poly(Glu, Tyr) 4:1. MAPK1 was incubated with 25 mM Tris (pH 7.5), 0.02 mM EGTA, 250 µM substrate peptide (MAPK1-peptide), whereas PDK1 was incubated with 50 mM Tris (pH 7.5), 100 µM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC (PDKtide). The incubation was followed by the addition of 10 mM magnesium acetate and gamma-P33-ATP to each kinase. The kinase reactions were initiated with the addition of Mg:ATP mixture and stopped after 40 min of incubation with the addition of 3% phosphoric acid solution. |
| Affinity data for this assay | |
|---|---|
| If you find an error in this entry please send us an E-mail | |
|
Home |
| |
Search |
| |
Deposit |
| |
SiteMap |
| |
About us |
| |
Email us |
| |
Info |
|
©2000 BindingDB. All rights reserved. |
|||||||||||||