Assay Method Information |
|
| ChEMBL_986807 (CHEMBL2438448) |
Description: | Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to substrate addition measured after 3 hrs by spectrophotometry |
Affinity data for this assay | |
---|---|
If you find an error in this entry please send us an E-mail |
Home |
| |
Search |
| |
Deposit |
| |
SiteMap |
| |
About us |
| |
Email us |
| |
Info |
|
©2000 BindingDB. All rights reserved. |