Assay Method Information |
|
| ChEMBL_1663585 (CHEMBL4013266) |
Description: | Inhibition of human ADAMTS5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasma by Alphascreen assay |
Affinity data for this assay | |
---|---|
If you find an error in this entry please send us an E-mail |
Home |
| |
Search |
| |
Deposit |
| |
SiteMap |
| |
About us |
| |
Email us |
| |
Info |
|
©2000 BindingDB. All rights reserved. |