null

SMILES CC(C)n1cc(cn1)-c1nc(Nc2ccc3CCN(Cc3c2)C(=O)\C=C\C(=O)c2ccc(C)cc2)ncc1C

InChI Key

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 3 hits for monomerid = 50559293   

TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559293(CHEMBL4789273)copy SMILES
Affinity DataIC50: 25nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)TBA
LigandPNGBDBM50559293(CHEMBL4789273)copy SMILES
Affinity DataIC50: 51nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559293(CHEMBL4789273)copy SMILES
Affinity DataIC50: 0.900nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed