null
SMILES C[C@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1
InChI Key InChIKey=NPTUUUXCZCQNQS-QGHHPUGFSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 21 hits for monomerid = 194638
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
US Patent
Eli Lilly and Company
US Patent
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly and Company
US Patent
Eli Lilly and Company
US Patent
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif, 5(Rattus norvegicus (Rat))
Eli Lilly and Company
US Patent
Eli Lilly and Company
US Patent
Affinity DataIC50: 15nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly and Company
US Patent
Eli Lilly and Company
US Patent
Affinity DataIC50: 183nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
Affinity DataIC50: 1.75E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 2.85E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.20E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 9nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.11E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 3.89E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 17.9nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
US Patent
Eli Lilly and Company
US Patent
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.90E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Affinity DataIC50: 2.80E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair