null

SMILES CC(C)n1cc(cn1)-c1nc(Nc2ccc3CN(CC#N)CCc3c2)ncc1C

InChI Key

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 50559275   

TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 73nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 58nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 647nMAssay Description:Inhibition of FLT3 ITD mutant in human MOLM13 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 108nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 7nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 54nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 56nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))TBA
LigandPNGBDBM50559275(CHEMBL4798378)copy SMILES
Affinity DataIC50: 43nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed