TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 0.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 1.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK2/Cyclin A (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of CDK2/Cyclin A (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibition of CDK1/Cyclin B (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham
Curated by ChEMBL
University of Nottingham
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
![](/img/powered_by_small.gif)