Compile Data Set for Download or QSAR
Found 211 with Last Name = 'lingardo' and Initial = 'l'
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018836(CHEMBL3286826)copy SMILEScopy InChI
Affinity DataKi: <0.0200nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)copy SMILEScopy InChI
Affinity DataKi:  0.0200nMAssay Description:Inhibition of ROS1 (unknown origin) by Pfizer mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q29C6ZX5PubMed
TargetProto-oncogene tyrosine-protein kinase ROS(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)copy SMILEScopy InChI
Affinity DataKi: <0.0200nMAssay Description:Inhibition of ROS1 (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)copy SMILEScopy InChI
Affinity DataKi: <0.0700nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018837(CHEMBL3286827)copy SMILEScopy InChI
Affinity DataKi: <0.0700nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018836(CHEMBL3286826)copy SMILEScopy InChI
Affinity DataKi: <0.0800nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018829(CHEMBL3286819)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018828(CHEMBL3286818)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018839(CHEMBL3286829)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018835(CHEMBL3286825)copy SMILEScopy InChI
Affinity DataKi:  0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018833(CHEMBL3286823)copy SMILEScopy InChI
Affinity DataKi:  0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018825(CHEMBL3286815)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018838(CHEMBL3286828)copy SMILEScopy InChI
Affinity DataKi: <0.100nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018838(CHEMBL3286828)copy SMILEScopy InChI
Affinity DataKi:  0.120nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018821(CHEMBL3286811)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50448785(CHEMBL3128069)copy SMILEScopy InChI
Affinity DataKi:  0.200nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018832(CHEMBL3286822)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018835(CHEMBL3286825)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018823(CHEMBL3286813)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018833(CHEMBL3286823)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018818(CHEMBL3128075)copy SMILEScopy InChI
Affinity DataKi: <0.200nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018825(CHEMBL3286815)copy SMILEScopy InChI
Affinity DataKi:  0.220nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)copy SMILEScopy InChI
Affinity DataKi:  0.290nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018824(CHEMBL3286814)copy SMILEScopy InChI
Affinity DataKi:  0.360nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018826(CHEMBL3286816)copy SMILEScopy InChI
Affinity DataKi:  0.380nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018837(CHEMBL3286827)copy SMILEScopy InChI
Affinity DataKi:  0.400nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018839(CHEMBL3286829)copy SMILEScopy InChI
Affinity DataKi:  0.400nMAssay Description:Inhibition of TRKB (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetBDNF/NT-3 growth factors receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018815(CHEMBL3286820)copy SMILEScopy InChI
Affinity DataKi:  0.5nMAssay Description:Inhibition of TRKB (unknown origin) by off-chip mobility shift assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018842(CHEMBL3286832)copy SMILEScopy InChI
Affinity DataKi:  0.560nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018828(CHEMBL3286818)copy SMILEScopy InChI
Affinity DataKi:  0.570nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018829(CHEMBL3286819)copy SMILEScopy InChI
Affinity DataKi:  0.620nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018830(CHEMBL3286830 | US10543199, Compound PF-06463922 |...)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018821(CHEMBL3286811)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50306682((R)-3-(1-(2,6-dichloro-3-fluorophenyl)ethoxy)-5-(1...)copy SMILEScopy InChI
Affinity DataKi:  0.740nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018822(CHEMBL3286812)copy SMILEScopy InChI
Affinity DataKi:  0.850nMAssay Description:Inhibition of wild type human recombinant ALK kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-CONH...More data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018823(CHEMBL3286813)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018824(CHEMBL3286814)copy SMILEScopy InChI
Affinity DataKi:  1.60nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018832(CHEMBL3286822)copy SMILEScopy InChI
Affinity DataKi:  1.90nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50018841(CHEMBL3286831)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of human recombinant ALK L1196M mutant kinase domain (amino acids 1093 to 1141) expressed in baculovirus system using 5'FAM-KKSRGDYMTMQIG-...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2K35W68PubMed
Displayed 1 to 50 (of 211 total ) | Next | Last >>
Jump to: