Compile Data Set for Download or QSAR
Found 747 with Last Name = 'xiang' and Initial = 'm'
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM14361((R,S)-Rolipram | 4-(3-cyclopentyloxy-4-methoxy-phe...)copy SMILEScopy InChI
Affinity DataKi:  0.00230nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220995(CHEMBL77788)copy SMILEScopy InChI
Affinity DataKi:  0.0190nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221005(CHEMBL75684)copy SMILEScopy InChI
Affinity DataKi:  0.0420nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220998(CHEMBL76382)copy SMILEScopy InChI
Affinity DataKi:  0.0460nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221003(CHEMBL432348)copy SMILEScopy InChI
Affinity DataKi:  0.0690nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220997(CHEMBL78237)copy SMILEScopy InChI
Affinity DataKi:  0.0920nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221006(CHEMBL77358)copy SMILEScopy InChI
Affinity DataKi:  0.146nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220999(CHEMBL77745)copy SMILEScopy InChI
Affinity DataKi:  0.336nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220996(CHEMBL76635)copy SMILEScopy InChI
Affinity DataKi:  1.20nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221004(CHEMBL77999)copy SMILEScopy InChI
Affinity DataKi:  1.60nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221001(CHEMBL76257)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220993(CHEMBL78238)copy SMILEScopy InChI
Affinity DataKi:  2.30nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221007(CHEMBL80258)copy SMILEScopy InChI
Affinity DataKi:  2.70nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221002(CHEMBL306320)copy SMILEScopy InChI
Affinity DataKi:  3.5nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221000(CHEMBL431962)copy SMILEScopy InChI
Affinity DataKi: >5nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220994(CHEMBL77177)copy SMILEScopy InChI
Affinity DataKi: >5nMAssay Description:Binding affinity towards rolipram binding site on phosphodiesterase 4 using [3H]rolipram as radioligand in crude rat brain homogenateMore data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetFatty acid-binding protein, adipocyte(Rattus norvegicus)
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50212873(((2'-(5-ETHYL-3,4-DIPHENYL-1H-PYRAZOL-1-YL)-3-BIPH...)copy SMILEScopy InChI
Affinity DataKi:  29nMAssay Description:Inhibition of rat ap2 by fluorescent 1,8-anilino-8-naphthalene sulfonate assayMore data for this Ligand-Target Pair
TargetFatty acid-binding protein, adipocyte(Rattus norvegicus)
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50381857(CHEMBL2023268)copy SMILEScopy InChI
Affinity DataKi:  33nMAssay Description:Inhibition of rat ap2 by fluorescent 1,8-anilino-8-naphthalene sulfonate assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q26H4JD5PubMed
TargetVasopressin V2 receptor(Homo sapiens (Human))
Johnson and Johnson Pharmaceutical Research and Development

Curated by ChEMBL
LigandPNGBDBM50146577(CHEMBL102311 | spirobenzoxazines analogues)copy SMILEScopy InChI
Affinity DataIC50: 0.200nMAssay Description:In vitro inhibitory concentration against [3H]-AVP binding to cloned human vasopressin receptorMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2BK1BSDPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM14361((R,S)-Rolipram | 4-(3-cyclopentyloxy-4-methoxy-phe...)copy SMILEScopy InChI
Affinity DataIC50: 0.310nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetTyrosine-protein kinase Blk(Homo sapiens (Human))TBA
LigandPNGBDBM50357312(IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compo...)copy SMILEScopy InChI
Affinity DataIC50: 0.5nMAssay Description:Inhibition of BLK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2P272TRPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220996(CHEMBL76635)copy SMILEScopy InChI
Affinity DataIC50: 0.580nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetReceptor tyrosine-protein kinase erbB-4(Homo sapiens (Human))
Sichuan University and Collaborative Innovation Center

Curated by ChEMBL
LigandPNGBDBM50357312(IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compo...)copy SMILEScopy InChI
Affinity DataIC50: 0.600nMAssay Description:Inhibition of HER4 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PR80BXPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221003(CHEMBL432348)copy SMILEScopy InChI
Affinity DataIC50: 0.600nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572387(CHEMBL4845662)copy SMILES
Affinity DataIC50: 0.670nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50505817(CHEMBL4447631)copy SMILEScopy InChI
Affinity DataIC50: 0.700nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamm33P]ATP by scintilla...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50505817(CHEMBL4447631)copy SMILEScopy InChI
Affinity DataIC50: 0.700nMAssay Description:Inhibition of human JAK2 (808 to end residues) using KTFCGTPEYLAP as substrate after 40 mins in presence of [gamma33P]-ATP by scintillation counting ...More data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Fudan University

Curated by ChEMBL
LigandPNGBDBM50322535(3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N...)copy SMILEScopy InChI
Affinity DataIC50: 0.700nMAssay Description:Inhibition of human FGFR1More data for this Ligand-Target Pair
TargetCytoplasmic tyrosine-protein kinase BMX(Homo sapiens (Human))TBA
LigandPNGBDBM50357312(IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compo...)copy SMILEScopy InChI
Affinity DataIC50: 0.800nMAssay Description:Inhibition of BMX (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2P272TRPubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559293(CHEMBL4789273)copy SMILES
Affinity DataIC50: 0.900nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50505819(CHEMBL4560698)copy SMILEScopy InChI
Affinity DataIC50: 1nMAssay Description:Inhibition of human JAK2 (808 to end residues) using KTFCGTPEYLAP as substrate after 40 mins in presence of [gamma33P]-ATP by scintillation counting ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25X2D7BPubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572387(CHEMBL4845662)copy SMILES
Affinity DataIC50: 1.10nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamm33P]ATP by scintilla...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetTyrosine-protein kinase BTK(Homo sapiens (Human))
Sichuan University and Collaborative Innovation Center

Curated by ChEMBL
LigandPNGBDBM50357312(IBRUTINIB | PCI-32765 | US10124003, Ref. Ex. Compo...)copy SMILEScopy InChI
Affinity DataIC50: 1.20nMAssay Description:Inhibition of BTK (unknown origin) in the presence of ATP by caliper mobility shift assayMore data for this Ligand-Target Pair
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220998(CHEMBL76382)copy SMILEScopy InChI
Affinity DataIC50: 1.40nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50221004(CHEMBL77999)copy SMILEScopy InChI
Affinity DataIC50: 1.60nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220993(CHEMBL78238)copy SMILEScopy InChI
Affinity DataIC50: 1.60nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572360(CHEMBL4867814)copy SMILES
Affinity DataIC50: 1.60nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
Fudan University

Curated by ChEMBL
LigandPNGBDBM50322535(3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N...)copy SMILEScopy InChI
Affinity DataIC50: 1.70nMAssay Description:Inhibition of human KDRMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2319ZMZPubMedDrugBank
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572367(CHEMBL4869302)copy SMILES
Affinity DataIC50: 1.80nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C(Rattus norvegicus)
LEAD GENE CO., LTD

Curated by ChEMBL
LigandPNGBDBM50220995(CHEMBL77788)copy SMILEScopy InChI
Affinity DataIC50: 1.80nMAssay Description:Inhibitory activity against purified rat liver phosphodiesterase 4More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2CZ39CGPubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572385(CHEMBL4851075)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572383(CHEMBL4873919)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572374(CHEMBL4862108)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559279(CHEMBL4754856)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
TargetVasopressin V1a receptor(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM50225162((4R)-N-[2-(dimethylamino)ethyl]-1-({4-[(2-phenylbe...)copy SMILEScopy InChI
Affinity DataIC50: 2nMAssay Description:Displacement of [3H]-Arg-vasopressin from human recombinant vasopressin V1a receptor expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2T72H5PPubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50505820(CHEMBL4436572)copy SMILEScopy InChI
Affinity DataIC50: 2nMAssay Description:Inhibition of human JAK2 (808 to end residues) using KTFCGTPEYLAP as substrate after 40 mins in presence of [gamma33P]-ATP by scintillation counting ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25X2D7BPubMed
TargetVasopressin V1a receptor(Homo sapiens (Human))
Johnson & Johnson Pharmaceutical Research & Development

Curated by ChEMBL
LigandPNGBDBM50366915(CHEMBL1788220)copy SMILEScopy InChI
Affinity DataIC50: 2nMAssay Description:Binding affinity measured by inhibition of 3[H] AVP binding to cloned human vasopressin V1a receptorMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2Z60PMQPubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50505817(CHEMBL4447631)copy SMILEScopy InChI
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))TBA
LigandPNGBDBM50572392(CHEMBL4865102)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sci...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N2750PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))TBA
LigandPNGBDBM50559295(CHEMBL4741075)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q28P6472PubMed
Displayed 1 to 50 (of 747 total ) | Next | Last >>
Jump to: