Compile Data Set for Download or QSAR
Found 299 with Last Name = 'yin' and Initial = 'mj'
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)copy SMILEScopy InChI
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)copy SMILEScopy InChI
Affinity DataKi:  0.111nMAssay Description:Inhibition of human PI3KgammaMore data for this Ligand-Target Pair
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)copy SMILEScopy InChI
Affinity DataKi:  0.122nMAssay Description:Inhibition of human PI3KdeltaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)copy SMILEScopy InChI
Affinity DataKi:  0.130nMAssay Description:Inhibition of human PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428109(CHEMBL2331668 | US8791131, 259)copy SMILEScopy InChI
Affinity DataKi:  0.191nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428109(CHEMBL2331668 | US8791131, 259)copy SMILEScopy InChI
Affinity DataKi:  0.243nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)copy SMILEScopy InChI
Affinity DataKi:  0.299nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50380320(CHEMBL2017653)copy SMILEScopy InChI
Affinity DataKi:  0.350nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2DJ5GN2PubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428111(CHEMBL2331666 | US8791131, 153)copy SMILEScopy InChI
Affinity DataKi:  0.377nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428108(CHEMBL2331669 | US8791131, 255)copy SMILEScopy InChI
Affinity DataKi:  0.395nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428113(CHEMBL2331663 | US8791131, 172)copy SMILEScopy InChI
Affinity DataKi:  0.532nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50428115(CHEMBL2331661 | US8791131, 136)copy SMILEScopy InChI
Affinity DataKi:  0.542nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50380313(CHEMBL1234354 | US8633204, 286)copy SMILEScopy InChI
Affinity DataKi:  0.570nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
LigandPNGBDBM50428110(CHEMBL2331667 | US8791131, 254)copy SMILEScopy InChI
Affinity DataKi:  0.584nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50380321(CHEMBL2017654)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2DJ5GN2PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428113(CHEMBL2331663 | US8791131, 172)copy SMILEScopy InChI
Affinity DataKi:  0.842nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50428111(CHEMBL2331666 | US8791131, 153)copy SMILEScopy InChI
Affinity DataKi:  0.922nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50428117(CHEMBL2331657)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428107(CHEMBL2331664 | PF-04979064 | US8791131, 257)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428110(CHEMBL2331667 | US8791131, 254)copy SMILEScopy InChI
Affinity DataKi:  1.60nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
LigandPNGBDBM50380314(CHEMBL2017648)copy SMILEScopy InChI
Affinity DataKi:  1.70nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2DJ5GN2PubMed
LigandPNGBDBM50380315(CHEMBL2017649)copy SMILEScopy InChI
Affinity DataKi:  1.80nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2DJ5GN2PubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159358(CHEMBL3787386)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
LigandPNGBDBM50428114(CHEMBL2331662 | US8791131, 173)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159347(CHEMBL3787662 | US9586965, Cpd 1)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428118(CHEMBL2331659 | US8791131, 134)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428115(CHEMBL2331661 | US8791131, 136)copy SMILEScopy InChI
Affinity DataKi:  2.20nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428114(CHEMBL2331662 | US8791131, 173)copy SMILEScopy InChI
Affinity DataKi:  2.30nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428108(CHEMBL2331669 | US8791131, 255)copy SMILEScopy InChI
Affinity DataKi:  2.60nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159352(CHEMBL3786802)copy SMILEScopy InChI
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159353(CHEMBL3787220)copy SMILEScopy InChI
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159349(CHEMBL3786962)copy SMILEScopy InChI
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
LigandPNGBDBM50380316(CHEMBL2017650)copy SMILEScopy InChI
Affinity DataKi:  3nMAssay Description:Inhibition of PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2DJ5GN2PubMed
LigandPNGBDBM50428112(CHEMBL2331665 | US8791131, 162)copy SMILEScopy InChI
Affinity DataKi:  3.90nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159360(CHEMBL3786098)copy SMILEScopy InChI
Affinity DataKi:  4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50159356(CHEMBL3786523)copy SMILEScopy InChI
Affinity DataKi:  4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2KS6TDDPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428117(CHEMBL2331657)copy SMILEScopy InChI
Affinity DataKi:  4.5nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50428119(CHEMBL2331658 | US8791131, 133)copy SMILEScopy InChI
Affinity DataKi:  4.70nMAssay Description:Inhibition of mTOR (unknown origin)More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50389285(CHEMBL2063759)copy SMILEScopy InChI
Affinity DataKi:  5nMAssay Description:Inhibition of mTORMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q29024WGPubMed
LigandPNGBDBM50428116(CHEMBL2331660)copy SMILEScopy InChI
Affinity DataKi:  5.70nMAssay Description:Inhibition of mouse PI3KalphaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1F0BPubMed
Displayed 1 to 50 (of 299 total ) | Next | Last >>
Jump to: