Compile Data Set for Download or QSAR
Found 224 with Last Name = 'tanis' and Initial = 'sp'
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361647(CHEMBL1940244)copy SMILEScopy InChI
Affinity DataKi:  35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361646(CHEMBL1940243)copy SMILEScopy InChI
Affinity DataKi:  100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361647(CHEMBL1940244)copy SMILEScopy InChI
Affinity DataKi:  250nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  260nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  320nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  360nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  370nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  430nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  500nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  570nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  650nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.10E+3nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  1.10E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.30E+3nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.90E+3nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  2.10E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  2.60E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  2.80E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483878(CHEMBL1773312)copy SMILEScopy InChI
Affinity DataIC50: 2.90nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483859(CHEMBL1773408)copy SMILEScopy InChI
Affinity DataIC50: 8.80nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50341243((3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylam...)copy SMILEScopy InChI
Affinity DataIC50: 10nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483863(CHEMBL1773324)copy SMILEScopy InChI
Affinity DataIC50: 11nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483864(CHEMBL1773322)copy SMILEScopy InChI
Affinity DataIC50: 11nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483871(CHEMBL1773323)copy SMILEScopy InChI
Affinity DataIC50: 12nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetDNA polymerase catalytic subunit(Human cytomegalovirus (HCMV strain AD169) )
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50210610(CHEMBL395623 | N-(4-chlorobenzyl)-2-(((2-(benzofur...)copy SMILEScopy InChI
Affinity DataIC50: 12nMAssay Description:Inhibition of HCMV DNA polymerase by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HX1DHNPubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483868(CHEMBL1773410)copy SMILEScopy InChI
Affinity DataIC50: 13nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483861(CHEMBL1773405)copy SMILEScopy InChI
Affinity DataIC50: 13nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483856(CHEMBL1773413)copy SMILEScopy InChI
Affinity DataIC50: 13nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
TargetIntegrase(Human immunodeficiency virus 1)
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50483860(CHEMBL1773406)copy SMILEScopy InChI
Affinity DataIC50: 13nMAssay Description:Inhibition of HIV-1 integrase strand transfer activity by scintillation proximity assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2514236PubMed
Displayed 1 to 50 (of 224 total ) | Next | Last >>
Jump to: