Compile Data Set for Download or QSAR
Found 73 Enz. Inhib. hit(s) with all data for entry = 50012455
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557765(CHEMBL4791414)copy SMILES
Affinity DataIC50: 0.310nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557761(CHEMBL4758580)copy SMILES
Affinity DataIC50: 0.560nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557764(CHEMBL4787891)copy SMILES
Affinity DataIC50: 0.610nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557766(CHEMBL4751832)copy SMILES
Affinity DataIC50: 0.830nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557742(CHEMBL4752199)copy SMILES
Affinity DataIC50: 1nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557760(CHEMBL4749011)copy SMILES
Affinity DataIC50: 1nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557753(CHEMBL4748097)copy SMILES
Affinity DataIC50: 1nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557756(CHEMBL4779273)copy SMILES
Affinity DataIC50: 1.10nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557755(CHEMBL4782729)copy SMILES
Affinity DataIC50: 1.20nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557744(CHEMBL4741185)copy SMILES
Affinity DataIC50: 1.5nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557763(CHEMBL4744618)copy SMILES
Affinity DataIC50: 1.60nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557767(CHEMBL4764221)copy SMILES
Affinity DataIC50: 2nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557759(CHEMBL4763627)copy SMILES
Affinity DataIC50: 2.90nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557746(CHEMBL4779579)copy SMILES
Affinity DataIC50: 2.90nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557757(CHEMBL4792464)copy SMILES
Affinity DataIC50: 3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557745(CHEMBL4741913)copy SMILES
Affinity DataIC50: 3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557754(CHEMBL4764416)copy SMILES
Affinity DataIC50: 3.30nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557758(CHEMBL4749061)copy SMILES
Affinity DataIC50: 3.60nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557743(CHEMBL4744988)copy SMILES
Affinity DataIC50: 3.70nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557747(CHEMBL4795223)copy SMILES
Affinity DataIC50: 3.90nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557739(CHEMBL4798505)copy SMILES
Affinity DataIC50: 5nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557762(CHEMBL4747422)copy SMILES
Affinity DataIC50: 7nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557740(CHEMBL4777071)copy SMILES
Affinity DataIC50: 7.90nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557741(CHEMBL4750258)copy SMILES
Affinity DataIC50: 15nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))TBA
LigandPNGBDBM50557768(CHEMBL4752410)copy SMILES
Affinity DataIC50: 18nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557752(CHEMBL4763122)copy SMILES
Affinity DataIC50: 36nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557749(CHEMBL4783244)copy SMILES
Affinity DataIC50: 75nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557750(CHEMBL4747912)copy SMILES
Affinity DataIC50: 110nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557751(CHEMBL4792978)copy SMILES
Affinity DataIC50: 180nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557745(CHEMBL4741913)copy SMILES
Affinity DataIC50: 190nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557742(CHEMBL4752199)copy SMILES
Affinity DataIC50: 310nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557751(CHEMBL4792978)copy SMILES
Affinity DataIC50: 490nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557760(CHEMBL4749011)copy SMILES
Affinity DataIC50: 530nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557743(CHEMBL4744988)copy SMILES
Affinity DataIC50: 630nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557744(CHEMBL4741185)copy SMILES
Affinity DataIC50: 700nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))TBA
LigandPNGBDBM50557742(CHEMBL4752199)copy SMILES
Affinity DataIC50: 710nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557762(CHEMBL4747422)copy SMILES
Affinity DataIC50: 800nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557763(CHEMBL4744618)copy SMILES
Affinity DataIC50: 860nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557752(CHEMBL4763122)copy SMILES
Affinity DataIC50: 960nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-2(Homo sapiens (Human))TBA
LigandPNGBDBM50557748(CHEMBL4745367)copy SMILES
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557747(CHEMBL4795223)copy SMILES
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557739(CHEMBL4798505)copy SMILES
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557741(CHEMBL4750258)copy SMILES
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557749(CHEMBL4783244)copy SMILES
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557746(CHEMBL4779579)copy SMILES
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))TBA
LigandPNGBDBM50557745(CHEMBL4741913)copy SMILES
Affinity DataIC50: 1.40E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))TBA
LigandPNGBDBM50557744(CHEMBL4741185)copy SMILES
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557756(CHEMBL4779273)copy SMILES
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))TBA
LigandPNGBDBM50557746(CHEMBL4779579)copy SMILES
Affinity DataIC50: 2.00E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557761(CHEMBL4758580)copy SMILES
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
Displayed 1 to 50 (of 73 total ) | Next | Last >>
Jump to: