Compile Data Set for Download or QSAR
Found 63 Enz. Inhib. hit(s) with all data for entry = 50034393
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361647(CHEMBL1940244)copy SMILEScopy InChI
Affinity DataKi:  35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361646(CHEMBL1940243)copy SMILEScopy InChI
Affinity DataKi:  100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361653(CHEMBL1940245)copy SMILEScopy InChI
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361647(CHEMBL1940244)copy SMILEScopy InChI
Affinity DataKi:  250nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  260nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  320nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  360nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  370nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  430nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  500nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361649(CHEMBL1938415)copy SMILEScopy InChI
Affinity DataKi:  570nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361641(CHEMBL1940247)copy SMILEScopy InChI
Affinity DataKi:  650nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)copy SMILEScopy InChI
Affinity DataKi:  1.10E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.10E+3nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  1.30E+3nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  1.90E+3nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)copy SMILEScopy InChI
Affinity DataKi:  2.10E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataKi:  2.60E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataKi:  2.80E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase mTOR(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)copy SMILEScopy InChI
Affinity DataKi:  3.90E+3nMAssay Description:Inhibition of GST-tagged mTOR assessed as phosphorylation at Thr46 in GFP-4E-BP1 substrate by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50341243((3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylam...)copy SMILEScopy InChI
Affinity DataIC50: 10nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 50nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataIC50: 70nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human SKOV3 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 70nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human SKOV3 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataIC50: 80nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50321582(1-(3-aminopropyl)-8-(3-(2-(dimethylamino)-2-oxoeth...)copy SMILEScopy InChI
Affinity DataIC50: 85nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 110nMAssay Description:Inhibition of MARK1More data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 120nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetAurora kinase A(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 140nMAssay Description:Inhibition of Aurora AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)copy SMILEScopy InChI
Affinity DataIC50: 160nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
TargetGlycogen synthase kinase-3 beta(Homo sapiens (Human))
Pfizer Inc.

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)copy SMILEScopy InChI
Affinity DataIC50: 180nMAssay Description:Inhibition of GSK3-betaMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q23N23TVPubMed
Displayed 1 to 50 (of 63 total ) | Next | Last >>
Jump to: