Found 66 Enz. Inhib. hit(s) with all data for entry = 50049290 TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Competitive inhibition against rat cytoplasmic thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 7nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 7nMAssay Description:Affinity towards cytoplasmic Thymidine kinase relative ot TdR; expressed as KM (TdR)/KiMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 8nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 9nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 12nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 13nMAssay Description:Competitive-noncompetitive inhibition against rat mitochondrial thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 14nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 18nMAssay Description:In vitro inhibitory activity against S-adenosyl-L-methionine decarboxylase using liver from rat in presence of 1 mM putrescineMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 18nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Affinity DataIC50: 26nMAssay Description:Competitive inhibition against rat cytoplasmic Thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 52nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 64nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Affinity DataIC50: 70nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 71nMAssay Description:Competitive inhibition against rat cytoplasmic Thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 140nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 150nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Affinity DataIC50: 150nMAssay Description:In vitro inhibitory activity against S-adenosyl-L-methionine decarboxylase using liver from rat in presence of 1 mM putrescineMore data for this Ligand-Target Pair
Affinity DataIC50: 270nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 280nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 310nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 320nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 340nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 660nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.60E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.00E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.80E+3nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.00E+3nMAssay Description:Non competitive binding inhibition constant(Ki) of rat adenylate kinase (AK III) isozymes was determinedMore data for this Ligand-Target Pair
Affinity DataIC50: 3.40E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3.40E+3nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
