![](/images/Email.png)
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 7nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 7nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 110nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly and Company
Curated by ChEMBL
Eli Lilly and Company
Curated by ChEMBL
Affinity DataIC50: 110nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair
![](/img/powered_by_small.gif)