BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:tRNA synthetase (GlyRS)
Syringe Reactant:BDBM2
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:10/01/07
 
ΔG°:-7.32±0.330 (kcal/mole)
pH:7.2±n/a
Log10Kb:5.40± 5.15
Temperature:298±n/a (K)
ΔH° :n/a
ΔHobs :-17.2±2.06 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:yes
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:1.01
ΔS° :-0.0300±0 (kcal/mole-K)
Comments:n/a
 
Citation Dignam JDNada SChaires JB Thermodynamic characterization of the binding of nucleotides to glycyl-tRNA synthetase. Biochemistry 42:5333-40 (2003) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
tRNA synthetase (GlyRS)
Source:Protein was expressed and purified from E. coli.
Purity:n/a
Prep. Method:Enzyme was purified by affinity chromatography.
Name:tRNA synthetase (GlyRS)
Synonyms:Glycine--tRNA ligase | Glycyl-tRNA synthetase
Type:Enzyme
Mol. Mass.:76917.70
Organism:Bombyx mori
Description:B. mori glycyltRNA synthetase was expressed in E. coli.
Residue:680
Sequence:
MADPKIEEILAPLRANVKEQGDLVRKLKEEKAPEIDIKKAVAELKTRKKILEDKELSLAP
AEDLFDRAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIHLWKKFFILQEQ
MLEVECSILTPEPVLKASGHVERFADLMTKDIKTGECFRLDHLIKGHLEKIKSDKNTKIE
LKAEIEDILIKLDGMNADEMSALMKRFEMKSPISGNDLTPPIEFNLMFNTQIGPSGLVKG
FLRPETAQGIFVNFKRLLEFNQGRLPFAAAQIGNSFRNEISPRSGLLRVREFTMCEIEHF
CDVKEHPKFESVKNTQSLLYSADNQEQGKPADLTTIGDAVCKGIVNNETLGYFMARIHMY
MLAVGIDPKRLRFRQHMGNEMAHYACDCWDAECLSSYGWIECVGCADRSAYDLTQHTKAT
GIRLAAEKKLPAPKQIEVVEAIANNGRIGKAFKKDSQAINDTLATLDNAALEEMQKELDS
NGEYTLITARGEFKLTPSLVNVKKTQKTIHVEEIIPSVIEPSFGVGRILYCILEHNFRMR
EGDEQRTYFSLPPTVAPMKCVVLPLSGNAEFQPFVRDLSQELITVDVSHKVDDSSGSIGR
RYARTDELGVPYAVTVDFDTIKEPHTVTLRERDSMRQVRLPMADVPTVVRDLSNSKILWS
DVEQKYPKFEQQETVKGTSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2
Source:Sigma-Aldrich
Purity:n/a
Prep. Method:n/a
NameBDBM2
Synonyms:({[({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy](hydroxy)phosphoryl}oxy)phosphonic acid | ATP | Brimonidine ATP | CHEMBL14249
TypeNucleoside or nucleotide
Emp. Form.C10H16N5O13P3
Mol. Mass.507.181
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.