Reaction Details |
| Report a problem with these data |
Target | Potassium channel subfamily K member 9 |
---|
Ligand | BDBM532162 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition of Recombinant TASK-1 and TASK-3 In Vitro |
---|
IC50 | 4.50±n/a nM |
---|
Citation | Delbeck, M; Hahn, M; Müller, T; Lustig, K; Anlahr, J; Collins, K; Nicolai, J; Beck-Broichsitter, M; Albus, U; Gehring, D; Rosenstein, B; Dang, H; Duan, D; Yang, J; Chen, D Substituted bridged diazepane derivatives and use thereof as TASK-1 and TASK-3 inhibitors US Patent US11208422 Publication Date 12/28/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Potassium channel subfamily K member 9 |
---|
Name: | Potassium channel subfamily K member 9 |
Synonyms: | Acid-sensitive potassium channel protein TASK-3 | KCNK9 | KCNK9_HUMAN | TASK3 | TWIK-related acid-sensitive K(+) channel 3 | Two pore K(+) channel KT3.2 | Two pore potassium channel KT3.2 |
Type: | PROTEIN |
Mol. Mass.: | 42276.04 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1457494 |
Residue: | 374 |
Sequence: | MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCT
CYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHS
FTDHQRLMKRRKSV
|
|
|
BDBM532162 |
---|
n/a |
---|
Name | BDBM532162 |
Synonyms: | 3-{[2-(4-Chlorophenyl)imidazo[1,2-a]pyrimidin-3-yl]methyl}-8-oxa-3,10-diazabicyclo[4.3.1]dec-10-yl](3-fluoro-6-methoxypyridin-2-yl)methanone (Enantiomer 1) | US11208422, Example 13 | US11208422, Example 14 | US11208422, Example 93 |
Type | Small organic molecule |
Emp. Form. | C27H26ClFN6O3 |
Mol. Mass. | 536.985 |
SMILES | COc1ccc(F)c(n1)C(=O)N1C2COCC1CN(Cc1c(nc3ncccn13)-c1ccc(Cl)cc1)CC2 |
Structure |
|