Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM587516 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Receptor Binding Assay |
---|
Ki | 22.0±n/a nM |
---|
Citation | Smith, RA; Rideout, DC; Myers, KJ; Kawasaki, A Analogs of dextromethorphan with balanced receptor activities US Patent US11535596 Publication Date 12/27/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM587516 |
---|
n/a |
---|
Name | BDBM587516 |
Synonyms: | US11535596, Compound CNS1-D5 |
Type | Small organic molecule |
Emp. Form. | C16H21NO |
Mol. Mass. | 243.344 |
SMILES | Oc1ccc2CC3NCCC4(CCCCC34)c2c1 |THB:17:16:15:7.9.8| |
Structure |
|