| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM18235 |
|---|
| Substrate/Competitor | BDBM18044 |
|---|
| Meas. Tech. | Determination of IC50 |
|---|
| IC50 | 2.9±n/a nM |
|---|
| Citation |  Chan, DC; Fu, H; Forsch, RA; Queener, SF; Rosowsky, A Design, synthesis, and antifolate activity of new analogues of piritrexim and other diaminopyrimidine dihydrofolate reductase inhibitors with omega-carboxyalkoxy or omega-carboxy-1-alkynyl substitution in the side chain. J Med Chem48:4420-31 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | Dihydrofolate reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19884.75 |
|---|
| Organism: | Mycobacterium avium |
|---|
| Description: | Recombinant Mycobacterium avium DHFR expressed in E. coli. |
|---|
| Residue: | 181 |
|---|
| Sequence: | MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
|
|
|
|---|
| BDBM18235 |
|---|
| BDBM18044 |
|---|
| Name | BDBM18235 |
|---|
| Synonyms: | 5-{2-[(2,4-diaminopteridin-6-yl)methyl]-2-azatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3,5,7,9,12,14-heptaen-6-yl}pent-4-ynoic acid | Pteridine analogue, 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21N7O2 |
|---|
| Mol. Mass. | 463.4906 |
|---|
| SMILES | Nc1nc(N)c2nc(CN3c4ccccc4C=Cc4cc(ccc34)C#CCCC(O)=O)cnc2n1 |c:17| |
|---|
| Structure | 
|
|---|
Search and Browse
