Reaction Details |
| Report a problem with these data |
Target | Thyroid hormone receptor alpha [148-410] |
---|
Ligand | BDBM18820 |
---|
Substrate/Competitor | Peptide SRC2-2 |
---|
Meas. Tech. | Fluorescence Polarization (FP) Competition Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 6900±700 nM |
---|
Comments | Viability (LD50) of ARO and U2OS cells in the presence of compound are 5.4 uM and 25.5 uM, respectively. The compound solubility in PBS buffer containing 5% DMSO is 152 uM. Permeability across an artificial membrane (PAMPA) of the compound is 1957 x 10-6 cm/s. |
---|
Citation | Arnold, LA; Kosinski, A; Estebanez-Perpina, E; Fletterick, RJ; Guy, RK Inhibitors of the Interaction of a Thyroid Hormone Receptor and Coactivators: Preliminary Structure-Activity Relationships. J Med Chem50:5269-5280 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Thyroid hormone receptor alpha [148-410] |
---|
Name: | Thyroid hormone receptor alpha [148-410] |
Synonyms: | C-erbA-alpha | EAR-7 | EAR7 | ERBA1 | NR1A1 | THA_HUMAN | THRA | THRA1 | THRA2 | Thyroid Hormone Receptor (TR-alpha) | Thyroid hormone receptor alpha | c-erbA-1 |
Type: | Ligand-Binding Domain |
Mol. Mass.: | 29441.97 |
Organism: | Homo sapiens (Human) |
Description: | The hTRalpha LBD (His6 residues E148 - V410) was cloned and expressed in E. coli. |
Residue: | 263 |
Sequence: | EEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDG
DKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRY
DPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMST
DRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEG
RPGGSLGVHPEGQQLLGMHVVQV
|
|
|
BDBM18820 |
---|
Peptide SRC2-2 |
---|
Name: | Peptide SRC2-2 |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2334.76 |
Organism: | n/a |
Description: | The peptide is labeled with 5-iodoacetamidofluorescien. |
Residue: | 20 |
Sequence: | |