Reaction Details |
| Report a problem with these data |
Target | Cathepsin B-like cysteine protease |
---|
Ligand | BDBM22061 |
---|
Substrate/Competitor | BDBM22047 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | >25000±n/a nM |
---|
Citation | Mallari, JP; Shelat, AA; Obrien, T; Caffrey, CR; Kosinski, A; Connelly, M; Harbut, M; Greenbaum, D; McKerrow, JH; Guy, RK Development of potent purine-derived nitrile inhibitors of the trypanosomal protease TbcatB. J Med Chem51:545-52 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Cathepsin B-like cysteine protease |
---|
Name: | Cathepsin B-like cysteine protease |
Synonyms: | CPC | Cathepsin B-Like Cysteine Protease (TbcatB) | Cysteine peptidase C | TbcatB |
Type: | Enzyme |
Mol. Mass.: | 37220.37 |
Organism: | Trypanosoma brucei |
Description: | Enzyme was expressed in yeast Pichia pastoris. |
Residue: | 340 |
Sequence: | MHLMRACITFCIASTAVVAVNAALVAEDAPVLSKAFVDRVNRLNRGIWKAKYDGVMQNIT
LREAKRLNGVIKKNNNASILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACG
SCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLV
SDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCNYTCDDPTIPVVNYRSWTSYALQGE
DDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKI
ANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPLAPNTA
|
|
|
BDBM22061 |
---|
BDBM22047 |
---|
Name | BDBM22061 |
Synonyms: | 9-cyclopentyl-6-{[(3-methylphenyl)methyl]amino}-9H-purine-2-carbonitrile | Compound 3{7,13} |
Type | Small organic molecule |
Emp. Form. | C19H20N6 |
Mol. Mass. | 332.4023 |
SMILES | Cc1cccc(CNc2nc(nc3n(cnc23)C2CCCC2)C#N)c1 |
Structure |
|