| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM377228 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pim Enzyme Assays |
|---|
| IC50 | <100±n/a nM |
|---|
| Citation |  Xue, C; Feng, H; Li, Y; Zhang, K Thiazolecarboxamides and pyridinecarboxamide compounds useful as Pim kinase inhibitors US Patent US10265307 Publication Date 4/23/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM377228 |
|---|
| n/a |
|---|
| Name | BDBM377228 |
|---|
| Synonyms: | 3-Amino-N-{4-[(3S)-3-aminopiperidin-1-yl]-7-hydroxy-6,7-dihydro-5H-cyclopenta[b]pyridin-3-yl}-6-(2,6-difluorophenyl)pyrazine-2-carboxamide | US10265307, Example 62-1 | US10517858, Example 62 (Diastereoisomer 1) | US10828290, Example 62 (Diastereoisomer 1) | US11229631, Example 62 Diastereoisomer 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H25F2N7O2 |
|---|
| Mol. Mass. | 481.4978 |
|---|
| SMILES | N[C@H]1CCCN(C1)c1c2CC[C@H](O)c2ncc1NC(=O)c1nc(cnc1N)-c1c(F)cccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
